Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: AcrIIA9

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) binding affinity to SpCas9 was demonstrated using biolayer interferometry, but detailed MoA is unknown.
Evidence A synthetic E. coli strain was engineered with a genetic circuit where SpCas9 targeted a plasmid-borne chloramphenicol resistance gene. If an anti-CRISPR protein inhibits Cas9, the strain retains chloramphenicol resistance and survives antibiotic selection (ECO_0007003). In vitro cleavage assay evidence (a biochemical assay where purified Cas9 protein and guide RNA are incubated with target DNA and a candidate ACR protein outside of any living cell) further supported anti-CRISPR activity. Direct binding is supported by biolayer Interferometry evidence (ECO_0006350).
MoA Category unknown
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Streptococcus pyogenes type II-A CRISPR-Cas
Relevant publication(s) DOI 10.1016/j.chom.2019.01.003
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source Metagenome
Defence system(s) inhibited by the protein Defences CRISPR-Cas

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

Pfam Name Pfam Acc Pfam Length Colour HMM Start HMM End Ali Start Ali End Env Start Env End Evalue
PcfK PF14058 139 1 139 2 141 2 141 2.7e-60

Sequence Viewer

Amino acid position: -

MKGTEHFKQTIKEYLDGRAQTDELFAVSYAKENKNLDDCITFILNQVKASGCCGMTDDEVWSLAIHYYDEDNIDVGNPISCGVVVNHKVELTEEEKAQARKEALKAYQEEEMRKIQQRHSKPKPTAKAAQSNQTELSLFDF