Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: AcrIIC1

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) binds to the Cas9 HNH nuclease domain and prevents cleavage of the nucleic acid sequence (allows DNA binding, blocks DNA cleavage).
Evidence Binding was determined by size-exclusion chromatography (ECO_0001184, doi: 10.1016/j.cell.2017.07.037).
MoA Category binds and inhibits host defence system
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Neisseria meningitidis type II-C CRISPR-Cas
Relevant publication(s) DOI 10.1016/j.cell.2016.11.017, 10.1016/j.cell.2017.07.037
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID 5VGB_B
Genome(s) encoding the protein Protein Source MGE in Brackiella oedipodis and Neisseria meningitidis
Defence system(s) inhibited by the protein Defences CRISPR-Cas

3D structure

PDB entry model.

A similar PDB structure exists: 5VGB_B

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MANKTYKIGKNAGYDGCGLCLAAISENEAIKVKYLRDICPDYDGDDKAEDWLRWGTDSRVKAAALEMEQYAYTSVGMASCWEFVEL