Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: AcrIIC2

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) binds Cas9 through interactions with the positively charged bridge helix, thereby preventing crRNA loading.
Evidence Binding is supported by x-ray crystallography evidence (ECO_0005670).
MoA Category binds and inhibits host defence system
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Neisseria meningitidis type II-C CRISPR-Cas
Relevant publication(s) DOI 10.1016/j.cell.2016.11.017
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID 6J9M_B
Genome(s) encoding the protein Protein Source MGE in Neisseria meningitidis
Defence system(s) inhibited by the protein Defences CRISPR-Cas

3D structure

PDB entry model.

A similar PDB structure exists: 6J9M_B

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MSKNNIFNKYPTIIHGEARGENDEFVVHTRYPRFLARKSFDDNFTGEMPAKPVNGELGQIGEPRRLAYDSRLGLWLSDFIMLDNNKPKNMEDWLGQLKAACDRIAADDLMLNEDAADLEGWDD