Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: AcrIIC3

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) interacts with the HNH domain of Cas9 and induces Cas9 dimerisation (hindering DNA binding).
Evidence Binding was supported by gel-filtration (ECO_0001049) and electron microscopy (ECO_0005033) evidence.
MoA Category binds and inhibits host defence system
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Neisseria meningitidis type II-C CRISPR-Cas
Relevant publication(s) DOI 10.1016/j.cell.2016.11.017, 10.1016/j.cell.2017.07.037
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID 6JHV_A
Genome(s) encoding the protein Protein Source Prophages in Neisseria meningitidis
Defence system(s) inhibited by the protein Defences CRISPR-Cas

3D structure

PDB entry model.

A similar PDB structure exists: 6JHV_A

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MFKRAIIFTSFNGFEKVSRTEKRRLAKIINARVSIIDEYLRAKDTNASLDGQYRAFLFNDESPAMTEFLAKLKAFAESCTGISIDAWEIEESEYVRLPVERRDFLAAANGKEIFKI