Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: AcrIIC4

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) binds to Cas9, blocking DNA binding.
Evidence AcrIIC4Hpa was identified as a Cas9 inhibitor through in vitro cleavage assays using recombinant NmeCas9 and sgRNA-loaded complexes. Addition of AcrIIC4Hpa blocked target DNA cleavage in a concentration-dependent manner, with full inhibition observed at approximately 20-fold molar excess. In E. coli phage Mu immunity assays, AcrIIC4Hpa expression rescued phage infectivity in strains expressing HpaCas9 (its cognate Cas9) and significantly reduced NmeCas9-mediated phage targeting, confirming in vivo inhibition. Co-purification assays demonstrated direct binding between AcrIIC4Hpa and both HpaCas9 and NmeCas9. In HEK293T cells, transient coexpression of AcrIIC4Hpa abolished NmeCas9 genome editing activity without affecting SpyCas9, showing subtype specificity. Electrophoretic mobility shift assays (ECO_0000096) revealed that AcrIIC4Hpa does not interfere with sgRNA loading but blocks target DNA binding, consistent with a mechanism that prevents stable Cas9-DNA association.
MoA Category binds and inhibits host defence system
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Neisseria meningitidis type II-C CRISPR-Cas
Relevant publication(s) DOI 10.1128/mBio.02321-18
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID 7F7P_A
Genome(s) encoding the protein Protein Source MGE in Haemophilus parainfluenza
Defence system(s) inhibited by the protein Defences CRISPR-Cas

3D structure

PDB entry model.

A similar PDB structure exists: 7F7P_A

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MKITSSNFATIATSENFAKLSVLPKNHREPIKGLFKSAVEQFSSARDFFKNENYSKELAEKFNKEAVNEAVEKLQKAIDLAEKQGIQF