Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: AcrIIC5

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) binds to Cas9, blocking DNA binding
Evidence AcrIIC5Smu was identified as a highly potent NmeCas9 inhibitor through in vitro cleavage assays where it blocked DNA cleavage at lower concentrations than AcrIIC4Hpa, achieving full inhibition at ~7-fold molar excess. In phage immunity assays, AcrIIC5Smu expression fully restored infectivity of phage Mu in E. coli strains expressing NmeCas9 and HpaCas9, indicating strong cross-species inhibition. Although no direct interaction with Cas9 was observed in bacterial co-purification, co-immunoprecipitation (ECO_0005644) from mammalian cell lysates confirmed physical binding between AcrIIC5Smu and NmeCas9. In HEK293T cells, AcrIIC5Smu expression abolished genome editing by NmeCas9 at multiple loci, while editing by SpyCas9 remained unaffected, demonstrating high specificity. Biochemical assays showed that AcrIIC5Smu does not disrupt sgRNA loading but prevents target DNA binding, reducing NmeCas9 DNA affinity by ~6-fold. In live-cell imaging, AcrIIC5Smu eliminated telomeric focus formation by dNmeCas9 while sparing dSpyCas9, verifying functional inhibition of DNA binding in human cells and supporting its utility as a precise anti-CRISPR off-switch.
MoA Category binds and inhibits host defence system
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Neisseria meningitidis type II-C CRISPR-Cas
Relevant publication(s) DOI 10.1128/mBio.02321-18
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID 8JB9
Genome(s) encoding the protein Protein Source MGE in Simonsiella muelleri
Defence system(s) inhibited by the protein Defences CRISPR-Cas

3D structure

PDB entry model.

A similar PDB structure exists: 8JB9

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MNNSIKFHVSYDGTARALFNTKEQAEKYCLVEEINDEMNGYKRKSWEEKLREENCASVQDWVEKNYTSSYSDLFNICEIEVSSAGQLVKIDNTEVDDFVENCYGFTLEDDLEEFNKAKQYLQKFYAECEN