Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: AcrIIC7

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) None
Evidence Ectopic expression of AcrIIC7 (ECO_0000017) abolished interference against target plasmid.
MoA Category unknown
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Listeria seeligeri type II-C CRISPR-Cas
Relevant publication(s) DOI 10.1038/s41586-024-07923-x
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source MGE in Listeria seeligeri
Defence system(s) inhibited by the protein Defences CRISPR-Cas

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

Pfam Name Pfam Acc Pfam Length Colour HMM Start HMM End Ali Start Ali End Env Start Env End Evalue
HTH_26 PF13443 63 2 57 62 119 61 122 6.3e-08
HTH_3 PF01381 55 1 54 62 118 62 119 1.1e-09

Sequence Viewer

Amino acid position: -

MNVIEAEKFLKPKTNTTTFKFLVDEKLTANLTGMKPIGRIDTQRFLESHRASEFKILLDNPLKELLNYYGLTQYYLQKEVGLSQSTVSKLISDNRPIGSFQFAVLLKIAEATNRSVGEVADQLKEFNDLRDA