Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: AcrIII-1

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) binds to cyclic tetra-adenylate and cleaves it into two linear diadenylates.
Evidence Ectopic expression of AcrIII-1 (SIRV1 gp29) enables infection of a sensitive phage SSeV a host with active type III-B CRISPR immunity (ECO_0000017). Plasmid encoding gp29 (AcrIII-1 gene) can transform in a host with active cA4 (Csx1), but not cA6 (Csm6). LC-MS results show AcrIII-1 cleaves cA4 to ApA>P and ApA (ECO_0001096). AcrIII-1 is crystallised with cA4 (ECO_0001823)
MoA Category degrades or sequesters molecules utilised by host defence systems
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Sulfolobus islandicus M.16.4 type III-B CRISPR-Cas
Relevant publication(s) DOI 10.1038/s41586-019-1909-5
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID 2X4I_A
Genome(s) encoding the protein Protein Source Sulfolobus islandicus rudivirus 1
Defence system(s) inhibited by the protein Defences CRISPR-Cas

3D structure

PDB entry model.

A similar PDB structure exists: 2X4I_A

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

Pfam Name Pfam Acc Pfam Length Colour HMM Start HMM End Ali Start Ali End Env Start Env End Evalue
STIV_B116-like PF08960 101 1 96 4 99 4 110 5.9e-31

Sequence Viewer

Amino acid position: -

MNKVYLANAFSINMLTKFPTKVVIDKIDRLEFCENIDNEDIINSIGHDSTIQLINSLCGTTFQKNRVEIKLEKEDKLYVVQISQRLEEGKILTLEEILKLYESGKVQFFEIIVD