Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: AcrIIIB1

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) Directly interacts with the Cmr-a complex
Evidence Genetic deletion of acrIIIB1 (deletion mutation phenotypic evidence, ECO_0001038) from the SIRV2 viral genome results in loss of viral infectivity in Sulfolobus islandicus strains with subtype III-B CRISPR-Cas systems, demonstrating restored CRISPR activity. Conversely, ectopic expression of acrIIIB1 (ECO_0000017) in a CRISPR-active host rescues viral infectivity, indicating inhibition of CRISPR function. Binding to the Cmr-a effector complexes is supported by co-purification in pull-down assays (co-purification evidence, ECO_0006074).
MoA Category binds and inhibits host defence system
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Sulfolobus islandicus LAL14/1 type III-B CRISPR-Cas
Relevant publication(s) DOI 10.1016/j.cell.2019.09.003
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source Sulfolobus islandicus rod-shaped virus 2
Defence system(s) inhibited by the protein Defences CRISPR-Cas

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MEVKQIKKLNNLPWVFLDTYLNKFALDKNFVNCAYYSSRSGMTQEGCVQVMQVGDNFKVDTMREVHGIYFTPHASIISLIYRQKGIRSIDDLKEILGSLNLSKVSPKHYQLLVKYSNYTIEIYDIYFKGHIYEFPLVSQQGHLNVYNVPEPRNVYLIYYENNEEKKELNKDLFNEVSEFMIYNHRVTFEKPVLEFKNLQITPGGGALVYVPESMYVKLESSDHQSVEFRPSRDDWLLFSHPRPRRSGND