Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: AcrVA1

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) binds to Cas12a by mimicking the PAM and triggers cleavage of the target-recognition sequence of the Cas12a-bound guide RNA to inactivate the Cas12a complex (blocks DNA binding).
Evidence AcrVA1 was ectopically expressed in both bacterial and human cells (ECO_0000017). In P. aeruginosa expressing MbCas12a and targeting phage JBD30, AcrVA1 restored phage growth. In human U2-OS cells, AcrVA1 coexpression with Cas12a and EGFP-targeting crRNA abolished gene editing, confirming strong inhibition across multiple Cas12a orthologs. Size exclusion chromatography (ECO_0000325) demonstrated that AcrVA1 binds directly to both LbCas12a alone and LbCas12a-crRNA complexes, indicating crRNA-independent binding. Functional inhibition was confirmed by in vitro DNA cleavage assays, where addition of AcrVA1 completely blocked Cas12a endonuclease activity. Cryo-EM analysis (ECO_0006181) revealed AcrVA1 inserts into the PAM-binding cleft of Cas12a, mimicking the DNA PAM duplex and inducing structural rearrangements that displace the REC1 domain. AcrVA1 also exhibited Cas12a-dependent RNase activity, cleaving the crRNA guide. Cleavage resulted in two crRNA fragments, and was abolished by mutating key active site residues (R41A, H42A, H45A -- ECO_0001113) in AcrVA1’s α2 helix. Alanine substitutions at interaction interfaces (e.g., D95A/S96A) impaired both binding and RNase function (ECO_0001113). The crRNA cleavage was independent of Cas12a’s own nuclease activity, confirming AcrVA1 contains an intrinsic RNase active site. These findings support AcrVA1-mediated inhibition of Cas12a via dual mechanisms: PAM mimicry and destruction of crRNA guidance.
MoA Category binds and inhibits host defence system
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Moraxella bovoculi, Acidaminococcus sp. and Lachnospiraceae bacterium type V-A CRISPR-Cas
Relevant publication(s) DOI 10.1126/science.aau5174, 10.1016/j.chom.2019.05.004
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID 6NMD_B
Genome(s) encoding the protein Protein Source MGE in Moraxella bovoculi 58069
Defence system(s) inhibited by the protein Defences CRISPR-Cas

3D structure

PDB entry model.

A similar PDB structure exists: 6NMD_B

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MSKAMYEAKERYAKKKMQENTKIDTLTDEQHDALAQLCAFRHKFHSNKDSLFLSESAFSGEFSFEMQSDENSKLREVGLPTIEWSFYDNSHIPDDSFREWFNFANYSELSETIQEQGLELDLDDDETYELVYDELYTEAMGEYEELNQDIEKYLRRIDEEHGTQYCPTGFARLR