Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: AcrVA2

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) None
Evidence AcrVA2 and its ortholog AcrVA2.1 inhibited Cas12a in P. aeruginosa strains via ectopic expression (ECO_0000017), restoring phage titer in plaque assays targeting JBD30. However, they showed limited or no activity in human cell assays.
MoA Category unknown
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Moraxella bovoculi type V-A CRISPR-Cas
Relevant publication(s) DOI 10.1126/science.aau5174
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID 7CI1_A
Genome(s) encoding the protein Protein Source MGE in Moraxella bovoculi 58069
Defence system(s) inhibited by the protein Defences CRISPR-Cas

3D structure

PDB entry model.

A similar PDB structure exists: 7CI1_A

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MHHTIARMNAFNKAFANAKDCYKKMQAWHLLNKPKHAFFPMQNTPALDNGLAALYELRGGKEDAHILSILSRLYLYGAWRNTLGIYQLDEEIIKDCKELPDDTPTSIFLNLPDWCVYVDISSAQIATFDDGVAKHIKGFWAIYDIVEMNGINHDVLDFVVDTDTDDNVYVPQPFILSSGQSVAEVLDYGASLFDDDTSNTLIKGLLPYLLWLCVAEPDITYKGLPVSREELTRPKHSINKKTGAFVTPSEPFIYQIGERLGSEVRRYQSIIDGEQKRNRPHTKRPHIRRGHWHGYWQGTGQAKEFRVRWQPAVFVNSGRVSS