Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: AcrVA3

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) None
Evidence AcrVA3 displayed weak inhibition and toxicity in bacteria. Its ortholog AcrVA3.1 was ectopically expressed in P. aeruginosa (ECO_0000017), showing stronger inhibition of Cas12a and partial activity against type I-C, suggesting possible dual specificity without toxicity.
MoA Category unknown
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Moraxella bovoculi type V-A CRISPR-Cas
Relevant publication(s) DOI 10.1126/science.aau5174
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source MGE in Moraxella bovoculi 58069
Defence system(s) inhibited by the protein Defences CRISPR-Cas

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MVGKSKIDWQSIDWTKTNAQIAQECGRAYNTVCKMRGKLGKSHQGAKSPRKDKGISRPQPHLNRLEYQALATAKAKASPKAGRFETNTKAKTWTLKSPDNKTYTFTNLMHFVRTNPHLFDPDDVVWRTKSNGVEWCRASSGLALLAKRKKAPLSWKGWRLISLTKDNK