Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: AcrVA5

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) functions as an acetyltransferase and modifies Cas12a.
Evidence AcrVA5 was discovered within the same GF59 genomic fragment as AcrVA4, identified as GF59 candidate 3. The TXTL system includes plasmids that encode fluorescent proteins (GFP and RFP). Guide RNAs (gRNAs) are also included that direct Cas12a to specifically target and cleave the reporter plasmids. TXTL screening showed elevated fluorescence of both reporters, suggesting CRISPR inhibition. In purified protein assays, AcrVA5 inhibited dsDNA cleavage by MbCas12a and LbCas12a, but not AsCas12a, and showed no inhibition of MbCas12a from strain 58069. In mammalian cells, AcrVA5 inhibited LbCas12a-mediated genome editing but did not impact AsCas12a or SpyCas9. These findings support AcrVA5 as a selective inhibitor of certain Cas12a orthologs.
MoA Category adds a post-translational modification and deactivates bacterial defence
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Moraxella bovoculi and Lachnospiraceae bacterium type V-A CRISPR-Cas
Relevant publication(s) DOI 10.1126/science.aau5138
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID 6IUF_A
Genome(s) encoding the protein Protein Source MGE in Moraxella bovoculi 58069
Defence system(s) inhibited by the protein Defences CRISPR-Cas

3D structure

PDB entry model.

A similar PDB structure exists: 6IUF_A

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MKIELSGGYICYSIEEDEVTIDMVEVTTKRQGIGSQLIDMVKDVAREVGLPIGLYAYPQDDSISQEDLIEFYFSNDFEYDPDDVDGRLMRWS