Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: AcrVA5Bsp

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) inhibits Cas12a via acetylation, similar to its remote structural homolog, AcrVA5.
Evidence In vitro assay showed ability to inhibit DNA cleavage by Cas12a (ECO_0000183).
MoA Category adds a post-translational modification and deactivates bacterial defence
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Lachnospiraceae bacterium type V-A CRISPR-Cas
Relevant publication(s) DOI 10.1038/s41467-024-45068-7
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source Bacteroidota phage (IMG_VR genome, ID: Ga0247610_10000168)
Defence system(s) inhibited by the protein Defences CRISPR-Cas
View homologs from eukaryotic dsDNA viruses

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MLEDRSSLFKIEWYASLDGIMCFNAYDAEHNWVHLGKVIVDVKNVEYERYKHLCNGNKLAKIVRVETDSEYCGWGVATELLKEVIRIYKDFNLYLLCHPMPRGHYDESHKTVKDLRRFYGKLGFVPCGELLPTMIRKAPLPTLGE