Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: AcrVIA2

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) inhibits type VI-A CRISPR immunity by causing crRNA degradation (may degrade crRNAs directly, but there is a possibility that AcrVIA2 prevents loading of crRNAs into Cas13).
Evidence Ectopic expression of AcrVIA2 (ECO_0000017) abolished Cas13-dependent interference against a plasmid target in L. seeligeri, as demonstrated by plasmid-targeting assays. The same ectopic expression restored infection by a Cas13-sensitive phage (ϕLS59), indicating functional suppression of CRISPR immunity. A DEAD-box mutant (DEFD→AAFD) of AcrVIA2 (ECO_0000015) was expressed at similar levels but failed to inhibit Cas13 activity, confirming that the helicase motif is essential for function.
MoA Category unknown
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Listeria seeligeri type VI-A CRISPR-Cas
Relevant publication(s) DOI 10.1038/s41586-024-07923-x
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source MGE in Listeria seeligeri
Defence system(s) inhibited by the protein Defences CRISPR-Cas
View homologs from eukaryotic dsDNA viruses

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

Pfam Name Pfam Acc Pfam Length Colour HMM Start HMM End Ali Start Ali End Env Start Env End Evalue
Cas3-like_C_2 PF22590 106 17 104 220 300 198 302 1.1e-09
DEAD PF00270 167 12 163 19 156 7 159 1.8e-17

Sequence Viewer

Amino acid position: -

MKNIHQKIQLNKLQVKTVQNKGKDLLINAPTGSGKTEASLLAVSDASKSVSYLLPTVVSTNVMYLRLKRDYKLNLSVQTSTKKEISNFAEGVHIKLECPDFALIDFIKTGKKTLGDTIICDEFDHYPEMVKSALMEYKHTFSETQIIFVSATLNKESLMGIDLEEIALDTEKNLIKYKVYPNDDFRMDDIINNGKAYGKKIGIIFNSISQLECFIKPGEDFYDDHFSKFKKGENDYIIHSQVDDYDKALAENAIVNNDFSVLIGTDSISYSIDVNFDILIMMASSEMATNIQRLGRCNRLNKHVTDYNLYFFGSYLSDLKAPFINENVAFNNLERITSSHLCISRKNINEIKKELPVSEIMEYIEVKKHVLDEEESLRPIPFKVRRGIEKEVVKFNAKGLKQTKVIKTYQTFNMMDLKYAFCEEYYYDKKNSRALDVIQQFDFENDWFDRGDFTVKLYNLKTEQQALKQLLLKLEEYIEPEAPDETDEDFYYRNPDILLKYTDYDKLFIKGWTYSILSIDGKTIYIA