Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: AcrVIA6+

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) binds to the Leptotrichia wadei Cas13a.
Evidence Ectopic expression (ECO_0000017) of AcrVIA6 from Rhodobacter capsulatus rescues phage infection from Cas13a in E. coli. In vitro assays confirm inhibition of Cas13a RNA cleavage (ECO_0000184). Co-immunoprecipitation confirms direct interaction with Cas13a (ECO_0005644).
MoA Category binds and inhibits host defence system
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Leptotrichia wadei type VI-A CRISPR-Cas
Relevant publication(s) DOI 10.1016/j.molcel.2020.03.033
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source MGE in Rhodobacter capsulat R121
Defence system(s) inhibited by the protein Defences CRISPR-Cas

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MADKVKSIQPGPIFYDVFLVYLRVIGTNLKDWCAPHGVTATNAKSAATGGWNGTKARALRQKMIDEVGEETFLRLYTERLRREAA