Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: ADG.17

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) acts as a Phd-like antitoxin, binding to and inhibiting the Doc toxin (a kinase that targets EF-Tu)
Evidence
MoA Category binds and inhibits host defence system
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Sulfolobus islandicus type II TA system PhD-Doc
Relevant publication(s) DOI 10.1038/s41467-024-48074-x
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source Sulfolobus islandicus rod-shaped virus
Defence system(s) inhibited by the protein Defences TA

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MARVHKLSAKQKKIIKRMHNRIDYILEKYKEYLDALAEFDRTGVLKIHGKVIYERKYNDQKK