Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: ArdB

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) None
Evidence When expressed in E. coli, ArdB inhibited four major subfamilies of Type I restriction–modification systems (RM types IA–ID), allowing bacteriophages to infect cells that would otherwise restrict them. This shows that ArdB confers anti‑restriction protection inside living cells. However, purified ArdB did not block the restriction activity of a model enzyme (EcoKI) in test-tube assays (in vitro). That implies that ArdB doesn’t act by binding directly to the restriction enzyme’s active site.
MoA Category unknown
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Escherichia coli type I RM
Relevant publication(s) DOI 10.1093/nar/gkp1144
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID 2WJ9
Genome(s) encoding the protein Protein Source Plasmid pKM101
Defence system(s) inhibited by the protein Defences RM

3D structure

PDB entry model.

A similar PDB structure exists: 2WJ9

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

Pfam Name Pfam Acc Pfam Length Colour HMM Start HMM End Ali Start Ali End Env Start Env End Evalue
Antirestrict PF03230 92 1 92 86 181 86 181 4e-39

Sequence Viewer

Amino acid position: -

MMNVMLPAPDLYSLSFIHITRISYMKTLSQNTTSSACAPETGLQQLVATIVPDEQRISFWPQHFGLIPQWVTLEPRVFGWMDRLCENYCGGIWNLYTLNNGGAFMAPEPDDDDDETWVLFNAMNGNRAEMSPEAAGIAACLMTYSHHACRTECYAMTVHYYRLRDYALQHPECSAIMRIID