Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: Arn

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) binds and inhibits the Rgl enzyme (restriction of non-glucosylated DNA) through DNA mimicry. Triggers Paris defence
Evidence
MoA Category binds and inhibits host defence system
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Escherichia coli type IV RM
Relevant publication(s) DOI 10.1038/260454a0, 10.1074/jbc.M114.590851
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID 3WX4
Genome(s) encoding the protein Protein Source Enterobacteria phage T4
Defence system(s) inhibited by the protein Defences RM

3D structure

PDB entry model.

A similar PDB structure exists: 3WX4

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

Pfam Name Pfam Acc Pfam Length Colour HMM Start HMM End Ali Start Ali End Env Start Env End Evalue
DM_Arn PF22134 79 1 79 9 87 9 87 9e-58

Sequence Viewer

Amino acid position: -

MIIDSQSVVQYTFKIDILEKLYKFLPNLYHSIVNELVEELHLENNDFLIGTYKDLSKAGYFYVIPAPGKNIDDVLKTIMIYVHDYEIEDYFE