Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: Atd1

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) depletes the starvation alarmones (p)ppGpp.
Evidence Pyrophosphatase assay measuring ppGpp-degrading activity of Atd1 confirms its function as a nucleotide pyrophosphohydrolase (ECO:0000005).
MoA Category degrades or sequesters molecules utilised by host defence systems
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype TIR response (in vitro)
Relevant publication(s) DOI 10.1016/j.celrep.2023.112305
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source Pectobacterium phage PcCB7V
Defence system(s) inhibited by the protein Defences gp29/gp30

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MEDKPGYHLDKIKKRRFGSLGKIQEEVEELVDAHRQGSHVMILVEMSDLYGAMQGFLEENYPGFKMEDLKKFSGITQRAFKNGYRG