Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: Bdi2

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) inhibit a broad range of nucleic-acid-targeting defense systems, but MoA is unknown
Evidence Ectopic expression (ECO_0000017) of Bdi2 in Pseudomonas aeruginosa inhibits Zorya type I, RADAR, Hypnos, and Druantia type I antiphage defense systems in plaque formation and culture collapse assays.
MoA Category unknown
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Druantia type I;Zorya type I;Hypnos;RADAR
Relevant publication(s) DOI 10.1016/j.chom.2025.06.010
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source Pseudomonas phage vB_PaeM_FBPa10
Defence system(s) inhibited by the protein Defences Druantia, Zorya, Hypnos, RADAR

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MAKILMACELLVGDEILTHVDVNDPVRRRAIVLRSGAAPHSKVSIEVSALIGADWVDFKLKLAGTILPSAYMTSTRSALAALPNRRTPWQKL