Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: CARD domain-containing protein

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) disrupts the interaction between the inflammasome complex and caspase, preventing activation of the caspase.
Evidence The evidence comes from a preprint (DOI: 10.1101/2023.05.28.542683), which later formed the basis of a peer-reviewed publication, though the specific experiments discussed here may were not included in the final paper. Co-expression of the CARD-like protein and the gasdermin system in cells led to increased phage sensitivity, implying inhibition of the defense. Infected cells expressing the CARD-like protein showed reduced gasdermin cleavage—a key step in gasdermin activation—supporting functional inhibition. Engineering the CARD-only gene into phage T4 under a native promoter resulted in T4 phages that were partially resistant to gasdermin-based immunity, confirming anti-defense activity in a different phage context.
MoA Category binds and inhibits host defence system
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Lysobacter Enzymogenes Gasdermins
Relevant publication(s) DOI 10.1038/s41586-024-08498-3
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source Acinetobacter phage 133
Defence system(s) inhibited by the protein Defences Gasdermin

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MIKVDRENIDAFAARIKNFELKAGESFTDYFMDSEVFAGSWGFWLIGKGYVERGNAIINAYNKANKKHWSDQELCFAVNASPLRWDAASNEFYPWGLDQGINLDLAINADYKLWAEFLISSDRYYEPFLKYLENFEAGGEY