Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: DadIII-1

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) None
Evidence Ectopic expression (ECO_0000017) of DadIII-1 in Pseudomonas aeruginosa inhibits Druantia type III-mediated antiphage defense in plaque formation and culture collapse assays.
MoA Category unknown
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Druantia type III
Relevant publication(s) DOI 10.1016/j.chom.2025.06.010
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source Pseudomonas phage vB_PaeM_FBPa21
Defence system(s) inhibited by the protein Defences Druantia

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MPSSSKRVDPSFIRESLRLLCGLFGPREPADGRKDQDRTLNSLGSGAAVLWAIAMSIEVYPVVVAAPELDRSGSSLEHHRAFVSKNMFRHRMFLYNVQLCFTSAQEEYTIS