Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: Dmd

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) binds toxins (LsoA and RnlA) and neutralises them.
Evidence Dmd of bacteriophage T4 was identified as a broad-spectrum antitoxin through phage infection experiments in E. coli. T4 Δdmd mutants exhibited severely impaired growth on E. coli strains carrying either the chromosomal rnlA-rnlB or the plasmid-encoded lsoA-lsoB toxin-antitoxin (TA) systems (ECO_0001175), implicating Dmd in suppression of both toxins (RnlA and LsoA). In contrast, wild-type T4 grew normally under the same conditions, indicating that Dmd inactivates these host toxins. Co-expression of Dmd rescued the growth defects caused by RnlA and LsoA overexpression in ΔrnlAB strains. Immunoprecipitation (ECO_0005644) and pull-down (ECO_0006249) assays confirmed direct physical interaction between Dmd and the toxins LsoA and RnlA. Upon T4 infection, host antitoxins RnlB and LsoB rapidly degraded, while Dmd accumulated and associated with the toxins, replacing native antitoxins and blocking toxin activity. These results demonstrate that Dmd acts as a protein antitoxin by directly binding and neutralizing multiple non-cognate toxins to promote T4 phage propagation.
MoA Category binds and inhibits host defence system
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Escherichia coli type II TA systems RnlA-RnlB and LsoA-LsoB
Relevant publication(s) DOI 10.1111/j.1365-2958.2012.07975.x
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID 5HY3_B
Genome(s) encoding the protein Protein Source Enterobacteria phage T4
Defence system(s) inhibited by the protein Defences TA

3D structure

PDB entry model.

A similar PDB structure exists: 5HY3_B

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

Pfam Name Pfam Acc Pfam Length Colour HMM Start HMM End Ali Start Ali End Env Start Env End Evalue
Dmd PF17587 60 1 60 1 60 1 60 1.7e-48

Sequence Viewer

Amino acid position: -

MELVKVVFMGWFKNESMFTKEITMMKDDVQWATTQYAEVNKALVKAFIDDKKVCEVDCRG