Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: DSR anti-defence 1

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) competes with the tail tube protein, DSR2's trigger, by binding DSR2 and inhibiting its NADase activity.
Evidence Homologous recombination allowed transfer of the DSAD1 gene from DSR2-resistant phages (SPbeta or phi3T) to DSR2-sensitive SPR phages, rendering the hybrid SPR phages resistant to DSR2 defense. Co-expression of DSAD1 with DSR2 in B. subtilis inhibited DSR2-mediated protection against SPR infection (ECO_0000017), confirming DSAD1’s role as an anti-defense protein. Pulldown assays (ECO_0006249) demonstrated a direct physical interaction between DSAD1 and DSR2.
MoA Category binds and inhibits host defence system
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Bacillus subtilis 29R type II DSR
Relevant publication(s) DOI 10.1038/s41564-022-01207-8
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source Bacillus phages SP-beta and phi3T
Defence system(s) inhibited by the protein Defences DSR

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MIEIFKDTGATHDLVYHSKINTFVWDVEFDIVLSDSKELNKCYFVKCFNPYRINGKCDFAVSSIDIFSEGKRLLIENEFNFKITKAVHVATSKDVTEIVLHLSERISSPFPIVKEVVYLD