Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: Enki

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) None
Evidence Ectopic expression (ECO_0000017) of Enki with AbiH and Retron defense systems restored phage infectivity from severe reductions (5.7 log units for AbiH, 3.2 for Retron), confirming its broad-spectrum anti-defense activity.
MoA Category unknown
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Vibrio cyclitrophicus superhost with AbiH and Retron type II (Ec86)
Relevant publication(s) DOI 10.1101/2024.06.14.598830
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source Vibrio phage 1.080.O.
Defence system(s) inhibited by the protein Defences AbiH, Retron

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

LNVAPFIRPLFLLVKSFFYHSYIPIVVKFKCLKCDVRAKRRAFSLVRHTLDI