Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: Gad2

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) None
Evidence Comparative genomics of closely related phages with differential sensitivity to the Gabija defence system identified Gad2 as a factor conferring resistance. Deletion of Gad2 from phage SPβL7 (ECO_0001038) rendered it susceptible to Gabija-mediated defence.
MoA Category unknown
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Bacillus cereus VD045 Gabija
Relevant publication(s) DOI 10.1038/s41586-023-06869-w
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source Bacillus phage SPbetaL6 and SPbetaL7
Defence system(s) inhibited by the protein Defences Gabija
View homologs from eukaryotic dsDNA viruses

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MSYQFEKNKLYAYLGEELVEALKRNEAIIAGGAITSLFNNKEINDVDIYFRSDKKACSFLEECWNSNVYVTSHTKKATLFIKKRLKLQMIHFKFFSDAESIFNTFDFTVCMGAFDFKTEAFTLHEDFLKHNSQRILKFNSQTAFPIVSLLRVQKYTDKEYTISKPEFIRIVLTCMDLTINTYEELKDQMGGMYGINYDKLFEDEKDEDFNLREAVDKIADMVLDEDYFKEPVNLEFNDLDDLLNDINKSPVMTLKINDDQYRIGLDGFLKESVSAPCTEIKLDTKDFFDKTNFYKFVRKQNGKLTSFYDKNFEYVIGEEAKAEGVIDSWSNSGKLFFNEKAAIEQSTYYGKEDGVLIEVKIKEKDFVDADNGKVEATACQVIREVSKDEWKEYISANNSK