Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: Gam

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) binds to the RecBCD complex and may bind to KiwaB. triggers retrons Se72 and Ec48, as well as Old nuclease.
Evidence Purified Gam protein inhibits all catalytic activities of RecBC DNase (measured using using radiolabeled DNA substrates), including its ATPase (measured by tracking hydrolysis of [γ-³²P]ATP) and exonuclease functions. Two-hybrid (ECO_0000068) and pull-down (ECO_0006249) assay showed binding between KwaB and Gam.
MoA Category binds and inhibits host defence system
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Escherichia coli RecBCD and Kiwa
Relevant publication(s) DOI 10.1073/pnas.70.8.2215, 10.1016/j.cell.2025.07.002
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID 2UUZ
Genome(s) encoding the protein Protein Source Enterobacteria phage lambda
Defence system(s) inhibited by the protein Defences RecBCD, Kiwa

3D structure

PDB entry model.

A similar PDB structure exists: 2UUZ

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

Pfam Name Pfam Acc Pfam Length Colour HMM Start HMM End Ali Start Ali End Env Start Env End Evalue
Gam PF06064 98 1 98 41 138 41 138 1e-66

Sequence Viewer

Amino acid position: -

MDINTETEIKQKHSLTPFPVFLISPAFRGRYFHSYFRSSAMNAYYIQDRLEAQSWARHYQQLAREEKEAELADDMEKGLPQHLFESLCIDHLQRHGASKKSITRAFDDDVEFQERMAEHIRYMVETIAHHQVDIDSEV