Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: Gnarl1

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) None
Evidence gnarl1 (orf48) enhanced infection by phage T5 in multiple E. coli strains where wild-type O-antigen structures normally block phage adsorption. Expression of gnarl1 (ECO_0000017) induced detectable downshifts in O-antigen banding patterns, similar to seroconverting lysogens. These effects were mirrored by host mutants lacking O-antigen biosynthesis genes. Together, these results indicate gnarl1 modifies or downregulates O-antigen to facilitate phage entry.
MoA Category unknown
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Escherichia coli O-antigen-based barrier
Relevant publication(s) DOI 10.1101/2023.04.06.535777
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source Klebsiella phage vB_KpnM_KpV79
Defence system(s) inhibited by the protein Defences O-antigen-based barrier

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MTEQDQRLKQFDEKLAELEKTIKQVQEQRREYINRKGLNK