Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: Gp1.2

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) binds and inhibits Dgt
Evidence Gp1.2 was structurally characterized by NMR and shown to bind directly to Dgt, as confirmed by cryo-EM of the Dgt–Gp1.2 complex with or without bound (d)GTP (ECO_0006181). Biochemical assays showed Gp1.2 is a mixed-type inhibitor, reducing both Vmax and increasing KM, with an IC50 of 160 nM. GTP alone competitively inhibited Dgt (KI ~120 µM), but in combination with Gp1.2, inhibition was synergistic, reducing Gp1.2’s IC50 to 27 nM and GTP’s IC50 to 310 nM.
MoA Category binds and inhibits host defence system
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Escherichia coli dGTPase
Relevant publication(s) DOI 10.1073/pnas.2123092119
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID 7U66
Genome(s) encoding the protein Protein Source Escherichia phage T7
Defence system(s) inhibited by the protein Defences dGTPase

3D structure

PDB entry model.

A similar PDB structure exists: 7U66

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

Pfam Name Pfam Acc Pfam Length Colour HMM Start HMM End Ali Start Ali End Env Start Env End Evalue
T7-like_gp12 PF10922 85 1 85 5 89 5 89 5.7e-64

Sequence Viewer

Amino acid position: -

GSFTMGRLYSGNLAAFKAATNKLFQLDLAVIYDDWYDAYTRKDCIRLRIEDRSGNLIDTSTFYHHDEDVLFNMCTDWLNHMYDQLKDWK