Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: Gp4.5

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) inhibits the Lon Protease activity (it degrades the antitoxin)
Evidence Ectopic expression of Gp4.5 in E. coli restored susceptibility to phage in strains otherwise resistant due to the presence of the sanaTA system (ECO_0000017). Co-immunoprecipitation supports direct interaction with the Lon protease (ECO_0006030).
MoA Category unknown
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Escherichia coli type II TA SanaTA
Relevant publication(s) DOI 10.1016/j.molcel.2013.02.002
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source Escherichia phage T7
Defence system(s) inhibited by the protein Defences TA

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

Pfam Name Pfam Acc Pfam Length Colour HMM Start HMM End Ali Start Ali End Env Start Env End Evalue
TA_inhibitor PF17574 89 1 89 1 89 1 89 2.3e-64

Sequence Viewer

Amino acid position: -

MSNVAETIRLSDTADQWNRRVHINVRNGKATMVYRWKDSKSSKNHTQRMTLTDEQALRLVNALTKAAVTAIHEAGRVNEAMAILDKIDN