Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: Gp5.9

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) mimics DNA and binds to the RecB subunit of RecBCD, competing sterically with DNA. Triggers retron Ec48 defence
Evidence Gp5.9 was identified as a RecBCD inhibitor through in vitro helicase assays using purified protein. Addition of Gp5.9 to RecBCD prevented DNA unwinding in a double-stranded break resection assay, indicating potent inhibition of RecBCD activity. The specificity of Gp5.9 for RecBCD was demonstrated by its lack of effect on the AddAB complex homologous to RecBCD. A quantitative fluorescence-based helicase assay showed Gp5.9 inhibits RecBCD with an IC50 of 1.3 nM. Electrophoretic mobility shift assays (ECO_0000096) confirmed that Gp5.9 prevents DNA binding by RecBCD, even in complexes already bound by Abc2, indicating a direct competitive mechanism. CryoEM structural analysis of the RecBCD-Gp5.9 complex revealed that Gp5.9 acts as a DNA mimic (ECO_0006181), occupying the DNA binding site on the RecB arm domain and sterically preventing substrate access. This binding mode explains the observed loss of helicase activity and validates Gp5.9’s function as an anti-RecBCD factor that protects phage DNA from degradation.
MoA Category binds and inhibits host defence system
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Escherichia coli RecBCD
Relevant publication(s) DOI 10.7554/eLife.83409
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID 8B1R_P
Genome(s) encoding the protein Protein Source Enterobacteria phage T4
Defence system(s) inhibited by the protein Defences RecBCD

3D structure

PDB entry model.

A similar PDB structure exists: 8B1R_P

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MSRDLVTIPRDVWNDIQGYIDSLERENDSLKNQLMEADEYVAELEEKLNGTS