Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: Had1

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) None
Evidence Comparative genomics of closely related phages with differential sensitivity to the Hachiman defence system identified Had1 as a factor conferring resistance. Deletion of Had1 from phage SBSphiJ4 (ECO_0001038) rendered it susceptible to Hachiman-mediated defence. Ectopic expression of Had1 in B. subtilis (ECO_0000017) with Hachiman allowed otherwise blocked phages to infect.
MoA Category unknown
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Bacillus cereus B4087 Hachiman
Relevant publication(s) DOI 10.1038/s41586-023-06869-w
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID 8TTO_A
Genome(s) encoding the protein Protein Source Bacillus phage SBSphiJ4
Defence system(s) inhibited by the protein Defences Hachiman

3D structure

PDB entry model.

A similar PDB structure exists: 8TTO_A

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MEEFKMTVWTNGKAIRKYTGQDKHPDTNPSKRMEWFKATAIIKPDTGDNNERD