Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: Hin1523

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) modifies adenine residues to N6-methyladenine.
Evidence Hin1523 was cloned from the Haemophilus influenzae Rd strain. Like Hia5, it exhibited DNA methyltransferase activity in vitro. Using [³H]-AdoMet and λ DNA, incorporation of methyl groups was confirmed and was absent in the D194A mutant (ECO_0000315). Thin-layer chromatography (ECO_0000325) identified m6A as the modified base. REase protection assays showed resistance of plasmid DNA from Hin1523-expressing E. coli to multiple methylation-sensitive restriction enzymes, though the protection was less extensive than that seen with Hia5. HPLC revealed that Hin1523 methylated ~30% of adenines in λ DNA. Kinetic analysis showed preference for CA and TA dinucleotides, with GA methylated less efficiently. Poly(A) tracts remained unmethylated, suggesting similar minimal sequence specificity as Hia5 but with lower catalytic efficiency.
MoA Category modifies phage molecules to avoid recognition
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Diverse set of REases from type I RM systems
Relevant publication(s) DOI 10.1093/nar/gkr1039
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source Prophage in Haemophilus influenzae
Defence system(s) inhibited by the protein Defences RM
View homologs from eukaryotic dsDNA viruses

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MSEYLEYQNAIEGKTMANKKTFKQAPLPFIGQKRMFLKHVEIVLNKHIDGEGEGWTIVDVFGGSGLLSHTAKQLKPKATVIYNDFDGYAERLNHIDDINRLRQIIFNCLHGIIPKNGRLSKEIKEEIINKINDFKGYKDLNCLASWLLFSGQQVGSVEALFAKDFWNCVRQSDYPTAEGYLDGIEVISESFHKLIPRYQNQDKVLLLLDPPYLCTRQESYKQATYFDLIDFLRLINLTKPPYIFFSSTKSEFIRYLNYMQESKTDNWRAFENYKRIVVKASASKDGIYEDNMIYKF