Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: Ipii

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) None
Evidence IpII (orf143) enhanced T2 and T6 phage infectivity in ECOR21, which normally restricts these phages via a fused Type IV R-M enzyme, GmrSD. In a ∆wecA background lacking O-antigen, transposon disruption of the GmrSD locus mimicked the effect of IpII, confirming it as the target. Cloned expression of GmrSD blocked T2, but this restriction was relieved by co-expression of IpII (ECO_0000017).
MoA Category unknown
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Escherichia coli type IV RM
Relevant publication(s) DOI 10.1101/2023.04.06.535777
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source Binds and inhibits the gmrS/gmrD complex (glucose-modified hydroxymethylcytosine restriction endonuclease)
Defence system(s) inhibited by the protein Defences RM

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MKTYQEFIAEARVGAGKLEAAVNKKAHSFHDLPDKDRKKLVSLYIDRERILALPGANEGKQAKPLNAVEKKIDNFASKFGMSMDDLQQAAIEAAKAIKDK