Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: KlcA

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) None
Evidence KlcA expression in E. coli enables infection by phages even in the presence of functional Type I RM systems IA–ID. This confirms robust anti‑restriction activity in living cells. Purified KlcA also doesn’t inhibit EcoKI enzyme activity in vitro.
MoA Category unknown
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Escherichia coli type I RM
Relevant publication(s) DOI 10.1093/nar/gkp1144
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID 2KMG
Genome(s) encoding the protein Protein Source Plasmid pBP136
Defence system(s) inhibited by the protein Defences RM

3D structure

PDB entry model.

A similar PDB structure exists: 2KMG

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

Pfam Name Pfam Acc Pfam Length Colour HMM Start HMM End Ali Start Ali End Env Start Env End Evalue
Antirestrict PF03230 92 1 92 47 142 47 142 1.2e-36

Sequence Viewer

Amino acid position: -

MNTEEQPVTASLVAEAQRLDFLPTYFGPRLMMRGEALVYAWMRRLCERYNGAYWHYYALSDGGFYMAPDLAGRLEIEVNGNGFRGELSADAAGIVATLFALGQLAAEIADTDAADALIDRYHFLRGFAAGHPEAAAIYRAID