Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: Lar

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) None
Evidence Lar anti-restriction protein (Lar) was identified as a functional homolog of Ral through restriction alleviation and modification enhancement assays in E. coli strains expressing the Type IA R-M system EcoKI. Lar activity was confirmed by expression of lar from the Rac prophage in sbcA mutants (E.colu) and the hybrid phage λreverse. Cloning of lar into plasmids (e.g., pGK10, pGK15) enabled restriction alleviation as measured by increased phage titre of unmodified λ on restricting strains (ECO_0000017). Enhancement of modification was demonstrated by infecting cells expressing lar with unmodified phage and showing increased protection of progeny (ECO_0000017).
MoA Category unknown
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Escherichia coli K-12 type 1 RM
Relevant publication(s) DOI 10.1111/j.1365-2958.1995.tb02438.x
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source Enterobacteria phage lambda
Defence system(s) inhibited by the protein Defences RM

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

Pfam Name Pfam Acc Pfam Length Colour HMM Start HMM End Ali Start Ali End Env Start Env End Evalue
Lar_restr_allev PF14354 58 2 58 5 54 4 54 3.8e-16

Sequence Viewer

Amino acid position: -

MRYEKVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV