Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: Lidtsur-17

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) None
Evidence Lidtsur-17 was shown to be a potent inhibitor of the Avs3 system. In the same pooled genetic screen with Lidtsur-6 and Forsur-7, Lidtsur-17 was among the most enriched genes, strongly rescuing SeAvs3-induced toxicity in E. coli. In vitro biochemical reconstitution demonstrated that Lidtsur-17 robustly blocked SeAvs3's DNA endonuclease activity in the presence of its trigger protein. In phage plaque assays, Lidtsur-17 restored phage infectivity on strains expressing Avs3, confirming its role in disabling Avs defense in vivo.
MoA Category unknown
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Salmonella enterica type III Avs
Relevant publication(s) DOI 10.1126/science.abm4096
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source Escherichia phage Lidtsur
Defence system(s) inhibited by the protein Defences Avs

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MAINFEKFNKQQLAVVCQLGNEIDATPDVHDIIEFRGGFIPKVVYVAAVRNNRVDSIGIIQPTRTGAVLARNVTLIASLSAKQMELEGDREGVVAMQMAASLAVRFACEETVHDSYHEWFLACEHVPSDLTETQLSLLFAGEVLDQMLHQLQGGLSELMEAARGVKRATLH