Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: Lidtsur-6

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) None
Evidence Lidtsur-6 also functioned as an Avs inhibitor, albeit with moderate activity. Identified in the genetic suppression screen, it was found to confer partial protection against SeAvs3-mediated toxicity. Its expression in plaque assays restored infectivity of phages on E. coli harboring SeAvs3, suggesting that it inhibits the defense system in vivo. It does not inhibit the defence system in vitro, suggesting a possible indirect or context-dependent mode of action, possibly affecting Avs assembly or activation.
MoA Category unknown
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Salmonella enterica type III Avs
Relevant publication(s) DOI 10.1126/science.abm4096
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source Escherichia phage Lidtsur
Defence system(s) inhibited by the protein Defences Avs

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MTKVTVLLTSDKVTLIALLGDAVEDTPSLALDIKPGSDLSAAIAELETQLKKPTAPIMFIVNGGGYSPEAAAQYSPEKVAEFTVDNPALDEFVAAVA