Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: Methylcarbamoylase_mom

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) Recognises the sequence 5'-(C or G)-A-(C or G)-N-(C or T)-3' and performs methylcarbamoylation of adenine, preventing recognition of phage DNA by type I (EcoKI and EcoBI) restriction nucleases.
Evidence Ectopic expression of the gene renders phages resistant to numerous restriction enzymes (ECO_0000017). The modification (methylcarbamoylation) was identified using liquid chromatography–electrospray ionisation mass spectrometry (ECO_0001582).
MoA Category modifies phage molecules to avoid recognition
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Escherichia coli type I and II RM
Relevant publication(s) DOI 10.1016/0042-6822(76)90232-4, 10.1016/0378-1119(85)90108-8, 10.1093/nar/gkaa319
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID 8BV8_A
Genome(s) encoding the protein Protein Source Escherichia phage Mu
Defence system(s) inhibited by the protein Defences RM

3D structure

PDB entry model.

A similar PDB structure exists: 8BV8_A

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MPASIPRRNIVGKEKKSRILTKPCVIEYEGQIVGYGSKELRVETISCWLARTIIQTKHYSRRFVNNSYLHLGVFSGRDLVGVLQWGYALNPNSGRRVVLETDNRGYMELNRMWLHDDMPRNSESRAISYALKVIRLLYPSVEWVQSFADERCGRAGVVYQASNFDFIGSHESTFYELDGEWYHEITMNAIKRGGQRGVYLRANKERAVVHKFNQYRYIRFLNKRARKRLNTKLFKVQPYPK