Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: Nergal

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) None
Evidence Ectopic co-expression (ECO_0000017) of Nergal with CBASS operons neutralized the defense effect, as evidenced by restored viral infectivity in the Vibrio superhost.
MoA Category unknown
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Vibrio cyclitrophicus superhost with type I CBASS
Relevant publication(s) DOI 10.1101/2024.06.14.598830
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source Vibrio phage 1.209.O.
Defence system(s) inhibited by the protein Defences CBASS

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MSKHRGKAKRRATWVQTKRSPKNKHRWETEVNRARRKLAYAEYHKMKNRRGRNYV