Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: Nip

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) binds directly to the TIR (NADase) domain of the anti-phage defense protein SpbK, inhibiting its NADase activity and thereby preventing abortive infection.
Evidence Nip (NADase inhibitor from phage) was identified as a phage-encoded counter-defense protein that inhibits the SpbK NADase defense system. Its activity was demonstrated through infection assays with wild-type Φ3T and a Δnip mutant. Deletion of nip from Φ3T (Φ3T Δnip) drastically reduced infectivity on B. subtilis strains expressing SpbK (ECO_0001038), whereas reintroduction of nip restored infectivity, confirming its necessity and sufficiency for counter-defense. Co-expression of nip in strains harboring both spbK and yonE abolished SpbK-dependent growth arrest and NAD⁺ depletion, demonstrating functional inhibition of NADase activity. Infection of spbK⁺ strains with Φ3T Δnip, but not with wild-type Φ3T, led to significant NAD⁺ depletion, further supporting this effect during infection. Co-immunoprecipitation experiments revealed that Nip binds directly to the TIR (NADase) domain of SpbK but not to its N-terminal domain. Additional immunoprecipitation assays showed formation of a tripartite complex among Nip, SpbK, and YonE, with Nip-SpbK interaction occurring independently of YonE. These data collectively demonstrate that Nip counteracts SpbK-mediated abortive infection by directly binding and inhibiting its enzymatic activity.
MoA Category binds and inhibits host defence system
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Bacillus subtilis SpbK
Relevant publication(s) DOI 10.1371/journal.pgen.1011551
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source Phage Φ3T
Defence system(s) inhibited by the protein Defences SpbK

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MTETKANANVKIHVLADETLSGIKREYVEVDRKAEVGEKIVIVDKNDPGDVYENGAIFTVDRDFPGKKHVESDAARCGGNLHGFILREEYRVLEPTDIVHIDGGRYELTNRKAKVGEKVITITKCDIYSKGEIGTVGYQSPPRYIYVRFETRATGWRVPHEDYRVLVPLDKCEKTFETKNSGYKEIKNLIHNDLGITKQDIQEMISVAVSNEVQKMSESGKLDSIAGVKIESLIEEGFRDGGRLLYGFRERVSQTVSDEVGKRIANVLNINVELKEERN