Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: Oad1 (OLD-antidefense 1)

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) binds to the OLD exonuclease.
Evidence Oad1 (OLD-antidefense 1) was identified as a direct anti-defense factor encoded by the ICP1 phage, capable of inhibiting the activity of the Class 1 OLD family nuclease Vc OLD. Comparative infection assays showed that ICP1⁽²⁰¹⁸⁾, unlike other ICP1 isolates, was able to robustly infect V. cholerae expressing Vc OLD, indicating the presence of a counter-defense mechanism. Plasmid-based expression (ECO_0000017) of candidate genes from ICP1⁽²⁰¹⁸⁾ revealed that only Gp205⁽²⁰¹⁸⁾ (Oad1) enabled ICP1⁽²⁰⁰⁶⁾ to overcome Vc OLD restriction, while the closely related Gp205⁽²⁰⁰⁶⁾ did not. Allelic swaps confirmed that Oad1 was sufficient to restore phage infectivity in a gp205-deletion mutant, and this activity extended to rescuing plaque size of the unrelated ICP3 phage. Mutational analysis pinpointed key residues (S135, K136, N144) in Oad1 important for counter-defense. Finally, co-immunoprecipitation (ECO_0000085) assays demonstrated a specific in vivo physical interaction between Oad1 and Vc OLD, absent with the non-functional Gp205⁽²⁰⁰⁶⁾ allele, confirming direct inhibition of Vc OLD by Oad1.
MoA Category binds and inhibits host defence system
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Vibrio cholerae Class 1 OLD nucleases
Relevant publication(s) DOI 10.1101/2025.01.06.631583
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source Vibrio phage ICP1
Defence system(s) inhibited by the protein Defences Old exonuclease

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MCTHIITISGEKLDELGKLIDHKHNINFSTKFSIYEKVPSTGADISESNDSKDKIRQQAKDILDKIQSHQEEEESTPEWMEGFEDLIRSDYVLRKGDYLLLEDLSLEQKVFLQNSLKTTTEFTFLEEDYNYAYFNSKGSFVGLNYGDPFVVKKITFNDLFIPKQ