Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: Ocr

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) binds to the DNA-binding groove of the type I DNA restriction/modification complex with higher affinity than DNA and blocks it. Triggers Paris defence.
Evidence Wild-type bacteriophage T7 is not subject to restriction by the Escherichia coli B and K restriction systems, but T7 mutants that are susceptible to such restriction have been isolated. These mutants are all defective in gene 0.3 (ECO_0000016), which encodes the Ocr protein. Ocr deletion mutants are unable to plate on restricting hosts (ECO_0001038). Moreover, T7 Δ0.3 mutants were blocked by BREX, while wild-type T7 (with intact Ocr) overcame BREX-mediated restriction (ECO_0000016). Complementation with plasmid-encoded Ocr restored infectivity (ECO_0000017), and Ocr was shown to physically interact with the BrxX methyltransferase (x-ray crystallography evidence, ECO_0005670).
MoA Category binds and inhibits host defence system
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Escherichia coli type I RM and type I BREX
Relevant publication(s) DOI 10.1016/0022-2836(75)90083-2, 10.1016/s1097-2765(02)00435-5, 10.1093/nar/gkaa290, 10.1038/s41467-025-57006-2
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID 1S7Z
Genome(s) encoding the protein Protein Source Escherichia phage T7
Defence system(s) inhibited by the protein Defences RM, BREX

3D structure

PDB entry model.

A similar PDB structure exists: 1S7Z

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

Pfam Name Pfam Acc Pfam Length Colour HMM Start HMM End Ali Start Ali End Env Start Env End Evalue
ocr PF08684 101 1 101 3 103 3 103 1.4e-66

Sequence Viewer

Amino acid position: -

MAMSNMTYNNVFDHAYEMLKENIRYDDIRDTDDLHDAIHMAADNAVPHYYADIFSVMASEGIDLEFEDSGLMPDTKDVIRILQARIYEQLTIDLWEDAEDLLNEYLEEVEEYEEDEE