Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: ORF126

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) None
Evidence orf126 was identified as a broad-spectrum counter-defense gene that enhanced phage infectivity in multiple E. coli strains. Its expression (ECO_0000017) increased plaquing efficiency for several phages, indicating suppression of host defenses. Transposon knockout of capsule and O-antigen biosynthesis genes phenocopied orf126 expression, suggesting that orf126 impairs surface barrier defenses. Affinity purification-mass spectrometry (AP-MS) revealed that orf126 shares host binding partners with known anti-defense protein orf116 (abc1), further supporting its counter-defense role (ECO_0001096).
MoA Category unknown
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype None
Relevant publication(s) DOI 10.1101/2023.04.06.535777
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source Enterobacteriophages
Defence system(s) inhibited by the protein Defences Broad-spectrum counter-defense

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MTIDYRRTYFFDTKRKVNNIISGIASLDIMIYAIQGKAGKEVLAEILSERNIAIPPTLRCLTPEELKALAFVVCKSQLKTTTVGGRMKVVLRVLLLITH