Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: ORF46

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) None
Evidence In Brex type I-bearing E. coli, ΔORF46 phages exhibited strongly reduced infectivity. Complementation with plasmid-encoded ORF46 fully restored infectivity, confirming its anti-Brex activity.
MoA Category unknown
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Escherichia coli type I BREX
Relevant publication(s) DOI 10.1101/2024.04.14.589459
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source DruSM1 phage
Defence system(s) inhibited by the protein Defences BREX

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MNEETVILMQKIQRLQDELNDAICRAASKKIHSELEIHQRQVTSEAVVEQVVVNLNISLKGF