Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: ORF71 (Druad1)

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) None
Evidence ORF71 deletion impaired infectivity of DruSM1 against E. coli harboring the Druantia type I defense system. Complementation restored infectivity and plaque size. ORF71 (Druad1) expression was linked to m6A DNA methylation, altering phage DNA to evade recognition by Druantia.
MoA Category unknown
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Escherichia coli type I Druantia
Relevant publication(s) DOI 10.1101/2024.04.14.589459
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source DruSM1 phage
Defence system(s) inhibited by the protein Defences Druantia

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MFTLEIKYFGSDWEVEDVFNNRYDAEQTGKFMLSQGLITNWRVL