Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: ORF83

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) None
Evidence Deletion of ORF83 significantly reduced infectivity (>100-fold EOP decrease) in AVAST type III-expressing bacteria. Ectopic expression of ORF83 in these strains restored infectivity of the ΔORF83 phage, confirming anti-AVAST activity.
MoA Category unknown
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Escherichia coli type III Avs
Relevant publication(s) DOI 10.1101/2024.04.14.589459
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source DruSM1 phage
Defence system(s) inhibited by the protein Defences Avs
View homologs from eukaryotic dsDNA viruses

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

Pfam Name Pfam Acc Pfam Length Colour HMM Start HMM End Ali Start Ali End Env Start Env End Evalue
YAcAr PF10686 66 3 64 3 64 1 65 1.7e-20

Sequence Viewer

Amino acid position: -

MLLVVTGGRDFKHAEYIYAQLDKLHMQRRITTLRHGDADGVDRICAQWAERNGIKTEAFPAPWDNLSLPNTKIRYNAKGAYNAQAGAYRNQLMLNTDPKPDHAIVFPGGAGTMDMYRRIKASGIPYTLAE