Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: P0021

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) None
Evidence Deletion of p0021 (ECO_0001038) alone did not abolish infectivity, but the double deletion of p0020 and p0021 reduced phage infectivity more than deletion of p0020 alone, suggesting that p0021 enhances the anti-defence function of p0020.
MoA Category unknown
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Vibrio crassostreae type ABCDEFGH Dnd
Relevant publication(s) DOI 10.1038/s41564-022-01157-1
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source Vibrio phage 44E38.1
Defence system(s) inhibited by the protein Defences Dnd

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MAQHVKVNPTTDEMLSKLSEKRKRENSFIRTKQDIAAEAIVALYKKEMKNG