Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: Psib

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) binds to RecA protein.
Evidence In a recA441 strain, which constitutively activates the SOS response, overexpression of PsiB from plasmid R6-5 or from an engineered F plasmid with a Tn10 promoter prevented LexA cleavage and SOS induction (as measured by sfiA expression). This demonstrated that PsiB directly inhibits RecA’s coprotease activity even without exogenous DNA damage. Immunoquantification showed that ~1500 PsiB tetramers per cell were sufficient to suppress RecA coprotease activity, even in cells with ~100,000 RecA monomers. However, suppression of UV-induced SOS required higher PsiB levels (~40,000 tetramers), indicating that PsiB targets a subset of RecA molecules—likely those bound to transient ssDNA during replication.
MoA Category binds and inhibits host defence system
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Escherichia coli SOS response
Relevant publication(s) DOI 10.1111/j.1365-2958.1992.tb01539.x, 10.1016/j.molcel.2009.07.026
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID 3NCT_A
Genome(s) encoding the protein Protein Source Escherichia coli plasmid
Defence system(s) inhibited by the protein Defences SOS stress response

3D structure

PDB entry model.

A similar PDB structure exists: 3NCT_A

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

Pfam Name Pfam Acc Pfam Length Colour HMM Start HMM End Ali Start Ali End Env Start Env End Evalue
PsiB PF06290 139 1 139 4 141 4 141 2.4e-64

Sequence Viewer

Amino acid position: -

MKTELTLNVLQTMNAQEYEDIRAAGSDERRELTHAVMRELDAPDNWTMNGEYGSEFGGFFPVQVRFTPAHERFHLALCSPGDVSQVWVLVLVNAGGEPFAVVQVQRRFASEAVSHSLALAASLDTQGYSVNDIIHILMAEGGQV